PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_26059-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 292aa    MW: 32357.2 Da    PI: 9.8092
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_26059-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_122.52.4e-071642091762
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                      A+rsR RK+++i+eLe kv++L++e  +   e+e l+++   l+ e
  TRIUR3_26059-P1 164 AQRSRVRKLQYIAELEGKVQSLQSEGIEVSAEMEFLTQQNIMLDLE 209
                      89***********************999999999888887666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-6153212IPR004827Basic-leucine zipper domain
CDDcd147031.33E-14154204No hitNo description
SuperFamilySSF579591.94E-6163206No hitNo description
Gene3DG3DSA:1.20.5.1701.7E-7164206No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MARSPGHRAP RTTALGMATL LDEPETPVRR AGHRRSSSDS FALFDGSAAS GAFANGFEEM  60
GGGGQAAPWG GVQEYYAKPS SYGRLQGRPW EQGMPNLAGY RPGPPVLVRE KLGGHHGPLS  120
ASRDHEHAMD KRALDELGAE RKDGVLPKYA QSEADTKRAK QQYAQRSRVR KLQYIAELEG  180
KVQSLQSEGI EVSAEMEFLT QQNIMLDLEN KALKQRLESI AQEQVIKRVQ QEMFEREIGR  240
LRSLYQQQQQ PPQPPTLGRS NSRDLDSQFA SMSLKQKDTN SGRDAVSGPL RT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ2666890.0GQ266689.1 Triticum aestivum bZIP type transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003577697.11e-158PREDICTED: uncharacterized protein At4g06598-like
TrEMBLT1N6J40.0T1N6J4_TRIUA; Uncharacterized protein
STRINGBRADI4G22130.11e-157(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33103666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.22e-50bZIP family protein